The Five Wishes Document is a pioneering approach to the traditional living will, focusing on the broader spectrum of personal, emotional and spiritual needs in addition to medical directives. It empowers individuals to outline their preferences for medical treatment, comfort levels, how they wish to be treated by others, and what they hope to communicate to their loved ones should they become seriously ill. Valid in most states when properly completed, this document transcends the clinical nature of standard advance directives by ensuring one's healthcare and personal dignity wishes are respected and honored.
When considering the future, one's health and well-being are among the most personal and complex topics to address. The Five Wishes document offers a comprehensive solution by allowing individuals to articulate their preferences concerning medical treatment, comfort levels, how they wish to be treated by others, and what they want their loved ones to know in the event that they become seriously ill. Recognized as the first living will to encompass personal, emotional, and spiritual needs in addition to medical wishes, the Five Wishes document stands out with its humanistic approach to end-of-life planning. Crafted with guidance from The American Bar Association's Commission on Law and Aging and leading experts in end-of-life care, its ease of use—requiring only a check, circle or brief statement to indicate preferences—makes it an accessible option for many. Valid in a majority of states once signed and properly completed, this document empowers individuals over 18, irrespective of their marital status or health condition, offering a way to ensure their personal dignity and peace of mind. Hospitals, hospices, faith communities, and legal professionals widely distribute Five Wishes, attesting to its utility and acceptance in facilitating crucial conversations around medical care and personal wishes among family members, friends, and caregivers. Thus, the Five Wishes document serves not only as an advance directive but as a compassionate guide for family decision-making during challenging times.
FIVE
WISH S®
M Y W I S H F O R :
The Person I Want too Make Car1e Decisions for Me When I Can’t
The Kind of Medical Treat2ment I Want or Don’t Want
How Comfortable3 I Want to Be
How I Want People4 to Treat Me
What I Want My Loved5 Ones to Know
print your name
birthdate
Five Wishes
There are many things in life that are out of our hands. This Five Wishes document gives you a way to control somethingg very
important—how you are treated if you get seriously ill. It is ann easy-to- complete form that lets you say exactly what you want. Once it is filled out and properly signed it is valid under the laws off most states.
What Is Five Wishes?
Five Wishes is the first living will that talks about your personal, emotional and spiritual needs as well as your medical wishes. It lets you choose the person you want to make health care decisions for you if you are not able to make them for yourselff. Five Wishes
lets you say exactly how you wish to be
treated if you get seriously ill. It was written with the help of The American Bar
$VVRFLDWLRQ·V&RPPLVVLRQRQ/DZDQG$JLQJ DQGWKHQDWLRQ·VOHDGLQJH[SHUWVLQHQGRIOLIH FDUH,W·VDOVRHDV\WRXVH$OO\RXKDYHWRGRLV check a box, circle a direction, or write a few
sentences.
How Five Wishes Can Help You And Your Family
•
It lets
you talk with your family,
WKH\ZRQ·WKDYHWRPDNHKDUGFKRLFHV
frie
without knowing your wishes.
nds and doctor about how you
wantt
to be treated if you become
• You can know what your mom, dad,
seriou
sly ill.
spouse, or friend wants. You can be
Your family membe
rs will not have to
there for them when they need you
t. It protects them
most. You will understand what they
guess what you wan
ously ill, because
really want.
if you become seri
How Five Wishes Began
For 12 years, Jim Towey worked closely with Mother Teresa, and, for one year, he lived in a KRVSLFHVKHUDQLQ:DVKLQJWRQ'&,QVSLUHGE\ WKLVILUVWKDQGH[SHULHQFH0U7RZH\VRXJKWD way for patients and their families to plan ahead and to cope with serious illness. The result is
2Five Wishes and the response to it has been
RYHUZKHOPLQJ,WKDVEHHQIHDWXUHGRQ&11 DQG1%&·V7RGD\6KRZDQGLQWKHSDJHVRI Time and MoneyPDJD]LQHV1HZVSDSHUVKDYH called Five Wishes the first “living will with a heart and soul.” Today, Five Wishes is available in 27 languages.
Who Should Use Five Wishes
Five Wishes is for anyone 18 or older — married, single, parents, adult children, and friends. More than 19 million people of all ages have already used it. Because it
works so well, lawyers, doctors, hospitals and hospices, faith communities, employers, and retiree groups are handing outt this document.
Five Wishes States
If you live in the District of Columbia or one of the 42 states listed below, youu can use )LYH:LVKHVDQGKDYHWKHSHDFHRIPLQGWRNQRZWKDWLWVXEVWDQWLDOO\PHHWV\RXUVWDWH·V requirements under the law:
Alaska
Illinois
Montana
6RXWK&DUROLQD
Arizona
Iowa
1HEUDVND
6RXWK'DNRWD
Arkansas
Kentucky
1HYDGDD
Tennessee
&DOLIRUQLD
/RXLVLDQD
1HZ-HUVH\
Vermont
&RORUDGR
Maine
1HZ0H[LFR
Virginia
&RQQHFWLFXW
Maryland
RUN
Washington
1HZ<
Delaware
Massachusetts
West Virginia
1RUWK&DUROLQD
Florida
Michigan
Wisconsin
1RUWK'DNRWD
Georgia
Minnesota
Oklahoma
Wyoming
Hawaii
Mississippi
Pennsylvania
Idaho
Missouri
Rhode Island
If your state is not one of the 42 states listed here, Five Wishes does not meet the technical UHTXLUHPHQWVLQWKHVWDWXWHVRI\RXUVWDWH6RVRPHGRFWRUVLQ\RXUVWDWHPD\EHUHOXFWDQW to honor Five Wishes. However, many people from states not on this list do complete Five :LVKHVDORQJZLWKWKHLUVWDWH·VOHJDOIRUP7KH\ILQGWKDW)LYH:LVKHVKHOSVWKHPH[SUHVV all that they want and provides a helpful guide to family members, friends, care givers and doctors. Most doctors and health care professionals know they need to listen to your wishes no matter how you express them.
How Do I Change To Five Wishes?
You may already have a living will or a durable power of attorney for health care. If you want to use Five Wishes instead, all you need to do is fill out and sign a new Five Wishes as directed. As soon as you sign it, it takes away any advance directive you had before. To make sure the right form is used, please do the following:
D
estroy all copies of your old living will
7HOO\RXU+HDOWK&DUH$JHQWIDPLO\
or durable power of attorney for health
members, and doctor that you have
care. Or you can write “revoked” in large
filled out a new Five Wishes.
letters across the copy you have. Tell
Make sure they know about your
your lawyer if he or she helped prepare
new wishes.
those old forms for you. AND
3
WISH 1
The Person I Want To Make Health Care Decisions For Me
When I Can’t Make Them For Myself.
f I am no longer able to make my own health care
• My attending or treating doctor finds I am no
I decisions, this form names the person I choose to
longer able to make health ca
es, AND
re choic
E
make these choices for me. This person will be my
• Another health care profe
ssional agrees
t
hat
Health Care Agent (or other term that may be used in
this is true.
MPLE
my state, such as proxy, representative, or surrogate).
If my state has a different
w
ay of finding that I am not
This person will make my health care choices if both
able to make health c
are choices, then my state’s way
of these things happen:
should be followe
d.
The Person I Choose As My Health Care Agent Is:
First Choice Name
Ph
one
Address
City/State/Zip
If this person is not able or willing to make thesee choices for me, OR is divorced or legally separated from me, OR this person has died, then these people aree my next choices:
Second Choice Name
e
Third Choice Nam
A
ddress
Phone
Picking The R
Your Health Care Agent
ight Person To Be
&KRRVHVRPHRQHZKRNQRZV\RXYHU\ZHOO
DQGIROORZ\RXUZLVKHV<RXU+HDOWK&DUH
can make difficult
Agent should be at least 18 years or older (in
cares about you, and who
ily member may
&RORUDGR\HDUVRUROGHUDQGVKRXOGnot be:
decisions. A spouse or fam
not be the best choice because they are too
Your health care provider, including the
YHG6RPHWLPHVWKH\are the
HPRWLRQDOO\LQYRO
owner or operator of a health or residential
EHVWFKRLFH<RX
NQRZEHVW&KRRVHVRPHRQH
or community care facility serving you.
ho is able to stand up for you so that your
wishes are followed. Also, choose someone who
An employee or spouse of an employee of
is likely to be nearby so that they can help when
your health care provider.
you need them. Whether you choose a spouse,
SAMIDPLO\PHPEHURUIULHQGDV\RXU+HDOWK&DUH
6HUYLQJDVDQDJHQWRUSUR[\IRURU
Agent, make sure you talk about these wishes
more people unless he or she is your
and be sure that this person agrees to respect
spouse or close relative.
4
I understand that my Health Care Agent can make health care decisions for me. I want my Agent to be able to do the
following: (Please cross out anything you don’t want your Agent to do that is listed below.)
Make choices for me about my medical care
6HH DQGDSSURYHUHOHDVHRIP\PHGLFDOUHFRUGV
or services, like tests, medicine, or surgery.
and personal files. If I need to sign my name to
This care or service could be to find out what my
JHWDQ\RIWKHVHILOHVP\+HDOW
$JHQWFDQ
K&DUH
health problem is, or how to treat it. It can also
sign it for me.
include care to keep me alive. If the treatment or
Move me to another
FDUHKDVDOUHDG\VWDUWHGP\+HDOWK&DUHAgent
state to get the care I need
or to carry out m
y wishes.
can keep it going or have it stopped.
•Interpret any instructions I have given in
this form or given in other discussions, according
WRP\+HDOWK&DUH$JHQW·VXQGHUVWDQGLQJRIP\ wishes and values.
&RQVHQWWRDGPLVVLRQWRDQDVVLVWHGOLYLQJIDFLOLW\ hospital, hospice, or nursing home for me. My +HDOWK&DUH$JHQWFDQKLUHDQ\NLQGRIKHDOWK care worker I may need to help me or take care of me. My Agent may also fire a health care worker, if needed.
•Make the decision to request, take away or not
JLYHPHGLFDOWUHDWPHQWVLQFOXGLQJDUWLILFLDOO\ provided food and water, andd any other treatments to keepp me alive.
•Authorize or refuse to authorize any medication or procedure needed to help with pain.
•Take any legal action needed to carry out my wishes.
•Donate useable organs or tissues of mine as allowed by law.
• Apply for Medicare, Medicaid, or other programs RULQVXUDQFHEHQHILWVIRUPH0\+HDOWK&DUH Agent can see my personal files, like bank records, to find out what is needed to fill out these forms.
/LVWHGEHORZDUHDQ\FKDQJHVDGGLWLRQVRU OLPLWDWLRQVRQP\+HDOWK&DUH$JHQW·VSRZHUV
______________________________________________________________________________
If I Change My Mind About Having A Health Care Agent, I Will
Destroy all copies of this part of the
• Write the word “Revoked” in large
Five Wishes form. OR
letters across the name of each agent
• Tell someone, such as my doctor or
whose authority I want to cancel.
6LJQP\QDPHRQWKDWSDJH
family, that I want to cancel or change
P\+HDOWK&DUH$JHQWOR
5
WISH 2
My Wish For The Kind Of Medical Treatment
I Want Or Don’t Want.
I b elieve that my life is precious and I deserve to be treated with dignity. When the timee comes that
I am very sick and am not able to speak for myself, I want the following wishes, and any other directions I have given to my Health Care Agent, to be respected and followed.
What You Should Keep In Mind As My Caregiver
•I do not want to be in pain. I want my doctor to give me enough medicine to relieve my pain, even if that means that I will be drowsy or sleep more than I would otherwise.
•I do nott want anything done or omitted by my doctors or nurses with the intention of taking my life.
•I want to be offered food and fluids by mouth, and kept clean and warm.
What “Life-Support Treatment” Means To Me
/LIHVXSSRUWWUHDWPHQWPHDQVDQ\PHGLFDOSURFH dure, device or medication to keep me alive.
/LIHVXSSRUWWUHDWPHQWLQFOXGHVPHGLFDO devices put in me to help me breathe; food and ZDWHUVXSSOLHGE\PHGLFDOGHYLFHWXEHIHHGLQJ FDUGLRSXOPRQDU\UHVXVFLWDWLRQ&35PDMRU surgery; blood transfusions; dialysis; antibiotics;
and anything else meant to keep me alive.
,I,ZLVKWROLPLWWKHPHDQLQJRIOLIHVXSSRUW treatment because of my religious or personal beliefs, I write this limitation in the space below. I do this to make very clear what I want and under what conditions.
_________________________________________________________________________________________
In Case Of An Emergency
Iff you have a medical emergency and ambulance personnel arrive, they may look to see if you have a Do Not Resuscitate form or bracelet. Many states require a person to have a Do Not Resuscitate form filled out and
signed by a doctor. This form lets ambulance SHUVRQQHONQRZWKDW\RXGRQ·WZDQWWKHPWRXVH OLIHVXSSRUWWUHDWPHQWZKHQ\RXDUHG\LQJ3OHDVH check with your doctor to see if you need to have a Do Not Resuscitate form filled out.
6
Here is the kind of medical treatment that I want or don’t want in the four situations listed below. I want my Health Care Agent, my family, my doctors and other health care providers, my friends and all others to know these directions.
Close to death:
If my doctor and another health care professional both decide that I am likely to die within a short period of WLPHDQGOLIHVXSSRUWWUHDWPHQWZRXOGRQO\GHOD\WKH PRPHQWRIP\GHDWK&KRRVHoneRIWKHIROORZLQJ
❏ ,ZDQWWRKDYHOLIHVXSSRUWWUHDWPHQW
❏ , GRQRWZDQWOLIHVXSSRUWWUHDWPHQW,ILWKDV been started, I want it stopped.
❏,ZDQWWRKDYHOLIHVXSSRUWWUHDWPHQWLIP\GRFWRU believes it could help. But I want my doctor to
VWRSJLYLQJPHOLIHVXSSRUWWUHDWPHQWLILWLVQRW helping my health condition or symptoms.
In A Coma And Not Expected Too Wake Up Or Recover:
If my doctor and another health care professional both decide that I am in a coma from which I am not expected WRZDNHXSRUUHFRYHUDQG,KDYHEUDLQGDPDJHDQGOLIH support treatment would only delay the moment of my GHDWK&KRRVHoneRIWKHIROORZLQJ
Permanent And Severe Brain Damage And Not Expected To Recover:
If my doctor and another health care professional both decide that I have permanentt and severe brain damage,
(for example, I can open myy eyes, but I can not speak RUXQGHUVWDQGDQG,DPQRWH[SHFWHGWRJHWEHWWHUDQG OLIHVXSSRUWWUHDWPHQWZRXOGRQO\GHOD\WKHPRPHQWRI P\GHDWK&KRRVHoneRIWKHIROORZLQJ
❏ ,GRQRWZDQWOLIHVXSSRUWWUHDWPHQW,ILWKDV been started, I want it stopped.
In Another Condition Under Which I Do Not Wish To Be Kept Alive:
If there is another condition under which I do not wish WRKDYHOLIHVXSSRUWWUHDWPHQW,GHVFULEHLWEHORZ,Q this condition, I believe that the costs and burdens of
OLIHVXSSRUWWUHDWPHQWDUHWRRPXFKDQGQRWZRUWKWKH benefits to me. Therefore, in this condition, I do not want OLIHVXSSRUWWUHDWPHQW)RUH[DPSOH\RXPD\ZULWH ´HQGVWDJHFRQGLWLRQµ7KDWPHDQVWKDW\RXUKHDOWKKDV gotten worse. You are not able to take care of yourself in DQ\ZD\PHQWDOO\RUSK\VLFDOO\/LIHVXSSRUWWUHDWPHQW will not help you recover. Please leave the space blank if \RXKDYHQRRWKHUFRQGLWLRQWRGHVFULEH
________________________________________________________________________________________
7
Th e next three wishes deal with my personal, spiritual and emotional wishes. They are important to me. I want to be treated with dignity near the end of my life, so I would like people to do the things
written in Wishes 3, 4, and 5 when they can be done. I understand that my family, my doctors and other health care providers, my friends, and others may not be able to do these things or are not required by law to do these things. I do not expect the following wishes to place new or added legal duties on my doctors or other health care providers. I also do not expect these wishes to excuse my doctor or other health care providers from giving mee the proper care asked for by law.
WISH 3
My Wish For How Comfortable I Want To Bee.
(Please cross out anything that you don’t agree with.)
•I do not want to be in pain. I want my doctor to give me enough medicine to relieve my pain, even if that means I will be drowsy or sleep more than I would otherwise.
•If I show signs of depression, nausea, shortness of breath, or hallucinations, I want my care givers to do whatever they can to help me.
•I wish to have a cool moist cloth put onn my head if I have a fever.
•I want my lips and mouth kept moist to stop dryness.
•I wish to have warm baths often. I wish to be kept fresh and clean at all times.
•I wishh to be massaged with warm oils as often as I can be.
•I wish to have my favorite music played when possible until my time of death.
•I wish to have personal care like shaving, nail clipping, hair brushing, and teeth brushing, as long as they do not cause me pain or discomfort.
,ZLVKWRKDYHUHOLJLRXVUHDGLQJVDQGZHOO loved poems read aloud when I am near death.
•I wish to know about options for hospice care to provide medical, emotional and spiritual care for me and my loved ones.
WISH 4
My Wish For How I Want People To Treat Me.
•I wish to have people with me when possible. I want someone to be with me when it seems that death may come at any time.
•I wish to have my hand held and to be talked
WRZKHQSRVVLEOHHYHQLI,GRQ·WVHHPWR respond to the voice or touch of others.
•I wish to have others by my side praying for me when possible.
•I wish to have the members of my faith community told that I am sick and asked to pray for me and visit me.
•I wish to be cared for with kindness and cheerfulness, and not sadness.
•I wish to have pictures of my loved ones in my room, near my bed.
•If I am not able to control my bowel or bladder functions, I wish for my clothes and bed linens to be kept clean, and for them to be changed as soon as they can be if they have been soiled.
•I want to die in my home, if that can be done.
8
WISH 5
My Wish For What I Want My Loved Ones To Know.
•I wish to have my family and friends know that I love them.
•I wish to be forgiven for the times I have hurt my family, friends, and others.
•I wish to have my family, friends and others know that I forgive them for when they may have hurt me in my life.
•I wish for my family and friends to know that I do not fear death itself. I think it is not the end, but a new beginning for me.
•I wish for all of my family members to make peace with each other before my death, if they can.
•I wish for my family and friends to think about what I was like before I became seriously ill. I want them too remember me in this way after my death.
•I wish for my family and friends and caregivers to respect my wishes even if
WKH\GRQ·WDJUHHZLWKWKHP
•I wish for my family and friends to look at my dying as a time of personal growth for everyone, including me. This will help me livee a meaningful life in my final days.
•I wish for my family and friends to get counseling if they have trouble with my death. I want memories of my life to give
WKHPMR\DQGQRWVRUURZ
•After my death, I would like my body to
EHFLUFOHRQHEXULHGRUFUHPDWHG
•My body or remains should be put in the
following
location
.
•The following person knows my funeral
wishes:.
If anyone asks how I want to be remembered, please say the following about me:
_________________________________________________________________________________
If there is to bee a memorial service for me, I wish for this service to include the following
OLVWPXVLFVRQJVUHDGLQJVRURWKHUVSHFLILFUHTXHVWVWKDW\RXKDYH
(Please use the space below for any other wishes. For example, you may want to donate any or all parts of your body when you die. You may also wish to designate a charity to receive memorial contributions. Please attach a VH DUDWHVKHHWRI D HULI\RXQHHGPRUHVSDFH
______________________________________________________________________________________
9
Signing The Five Wishes Form
Please make sure you sign your Five Wishes form in the presence of the two witnesses.
I, _________________________________, ask that my family, my doctors, and other health care providers,
P\IULHQGVDQGDOORWKHUVIROORZP\ZLVKHVDVFRPPXQLFDWHGE\P\+HDOWK&DUH$JHQWLI,KDYHRQHDQGKH RUVKHLVDYDLODEOHRUDVRWKHUZLVHH[SUHVVHGLQWKLVIRUP7KLVIRUPEHFRPHVYDOLGZKHQ,DPXQDEOHWRPDNH decisions or speak for myself. If any part of this form cannot be legally followed, I ask that all other parts of this form be followed. I also revoke any health care advance directives I have made before.
Signature:
___
Address:
Phone:
Date:
__
Witness Statement • (2 witnesses needed):
,WKHZLWQHVVGHFODUHWKDWWKHSHUVRQZKRVLJQHGRUDFNQRZOHGJHGWKLVIRUPKHUHDIWHU´SHUVRQµLVSHUVRQDOO\NQRZQWR PHWKDWKHVKHVLJQHGRUDFNQRZOHGJHGWKLV>+HDOWK&DUH$JHQWDQGRU/LYLQJ:LOOIRUPV@LQP\SUHVHQFHDQGWKDWKHVKH appears to be of sound mind and under no duress, fraud, or undue influence.
,DOVRGHFODUHWKDW,DPRYHU\HDUVRIDJHDQGDP127
•The individual appointed as (agent/proxy/
VXUURJDWHSDWLHQWDGYRFDWHUHSUHVHQWDWLYHE\ this document or his/her successor,
•7KHSHUVRQ·VKHDOWKFDUHSURYLGHULQFOXGLQJ RZQHURURSHUDWRURIDKHDOWKORQJWHUPFDUH or other residential or community care facility serving the person,
•$QHPSOR\HHRIWKHSHUVRQ·VKHDOWKFDUH provider,
•)LQDQFLDOO\UHVSRQVLEOHIRUWKHSHUVRQ·V health care,
•An employee of a life or health insurance provider for the person,
•Related to the person by blood, marriage, or adoption, and,
•To the best of my knowledge, a creditor of the person or entitled to any part of his/her estate under a will or codicil, by operation of law.
(Some states may have fewer rules about who may be a witness. Unless you know your state’s rules, please follow the above.)
Signature of Witness
Signature of Witness #2
#1
Printed Name of Witn
Printed Name of Witness
ess
Notarization • Only required for residents of Missouri, North Carolina, South Carolina and West Virginia
•If you live in Missouri, only your signature should be notarized.
•,I\RXOLYHLQ1RUWK&DUROLQD6RXWK&DUROLQDRU:HVW9LUJLQLD you should have your signature, and the signatures of your witnesses, notarized.
67$7(2)BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB&2817<2)BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
2QWKLVBBBBBGD\RIBBBBBBBBBBBBBBBBBBBBBBBWKHVDLGBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBDQGBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBNQRZQWRPHRUVDWLVIDFWRULO\SURYHQWREHWKHSHUVRQQDPHGLQWKH IRUHJRLQJLQVWUXPHQWDQGZLWQHVVHVUHVSHFWLYHO\SHUVRQDOO\DSSHDUHGEHIRUHPHD1RWDU\3XEOLFZLWKLQDQGIRUWKH6WDWHDQG&RXQW\DIRUHVDLGDQG acknowledged that they freely and voluntarily executed the same for the purposes stated therein.
0\&RPPLVVLRQ([SLUHV
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
10
1RWDU\3XEOLF
When it comes to planning for future healthcare decisions, the Five Wishes document is a unique tool that allows individuals to outline their preferences in personal, emotional, and spiritual care in addition to medical wishes. The simplicity of the form ensures that individuals can express their wishes clearly, making it easier for family members and healthcare providers to follow through when the time comes. Upon completion and proper witnessing, the document becomes legally valid in a majority of states, serving as a poignant reminder of one’s desires during critical health moments. The document is structured into five key wishes, guiding individuals through a comprehensive approach to planning for future healthcare decisions.
Here are the steps needed to properly fill out the Five Wishes Document:
After completing the Five Wishes document, remember to keep it in a safe, yet accessible place, and provide copies to your Health Care Agent, family members, and your doctor. Making these preparations in advance can bring peace of mind to you and your loved ones, ensuring decisions about your healthcare align with your personal desires and values.
What is the Five Wishes Document?
The Five Wishes Document is a comprehensive tool that allows individuals to dictate their preferences for medical treatment, comfort, and care in situations where they may be unable to communicate their desires directly. It addresses personal, emotional, spiritual, and medical aspects of end-of-life care, making it the first living will of its kind. Authored with the insight of The American Bar Association's Commission on Law and Aging and leading end-of-life care experts, it is designed to be easy to use, requiring the user to simply fill out their wishes in a straightforward format. Significantly, once properly completed and signed according to state laws, it is legally valid in most states.
Who should use Five Wishes?
Five Wishes is designed for anyone aged 18 or older, regardless of their current health status. This includes those who are married, single, parents, adult children, and friends. Over 19 million individuals across various ages have already utilized it, and it is recommended by professionals in legal, medical, and spiritual communities. Its universal applicability makes it a crucial document for anyone wishing to have their medical and personal wishes respected during serious illness or at the end of life.
Is Five Wishes recognized in all states?
Five Wishes meets the legal requirements for an advance directive in the District of Columbia and 42 states. If you reside outside of these areas, it is advisable to complete Five Wishes alongside your state’s legal form to ensure your wishes are known and considered. While not all states officially recognize Five Wishes due to varying technical requirements, many healthcare professionals and facilities across the country will respect the preferences outlined in it as it offers a clear expression of one's wishes for end-of-life care.
How can Five Wishes help families?
Five Wishes facilitates open conversations among family members, friends, and healthcare providers about one's personal wishes for medical treatment and end-of-life care, thus reducing uncertainty and stress in difficult times. By clearly outlining one's preferences, it helps ensure that family members are not left guessing about what their loved one wants, thereby preventing potential conflicts and ensuring that the person's wishes are respected. It also provides a sense of peace and preparedness for everyone involved.
What if I already have a living will or health care power of attorney?
If you currently have a living will or a health care power of attorney and wish to switch to Five Wishes, you simply need to complete and sign the Five Wishes document as directed, which automatically revokes any previous directives. It's important to communicate this change to your health care agent, family members, and care providers, and to destroy all copies of the old directives to prevent confusion and ensure that your current wishes are followed.
How do I choose the right person to make health care decisions for me?
Choosing a health care agent is a vital part of completing Five Wishes. This person should be someone you trust deeply, who understands your values, and is willing to advocate for your wishes, even in challenging circumstances. They should be at least 18 years of age and should not be your healthcare provider or an employee of your healthcare facility, to avoid potential conflicts of interest. Ensuring this person is willing and able to perform this role is crucial, as they will be responsible for making healthcare decisions on your behalf if you are unable to do so yourself.
Failing to select a health care agent who is consistently available or geographically nearby can create logistical challenges in emergency situations. If the chosen agent is unable to quickly travel or does not live close enough to be present when decisions need to be made, this can delay crucial healthcare actions.
Choosing a health care agent without discussing their wishes in depth with them can lead to misunderstandings or reluctance on the agent's part when it's time to make decisions. It's vital that the health care agent fully understands and agrees to carry out the individual's wishes.
Not considering the emotional capacity of the chosen health care agent can be a mistake. The role requires making difficult decisions under stress, and if the agent is overly emotional or unable to cope with the responsibility, they may not be able to act in the individual's best interest.
Overlooking the importance of alternates can be problematic. If the primary agent is unable or unwilling to serve at the necessary time, having no alternate agents listed can complicate the decision-making process.
Ignoring the legal and relationship status changes of the chosen agent (such as divorce or estrangement) can invalidate their suitability as a health care agent. Regularly revisiting and updating the document to reflect current relationships and statuses is crucial.
Not being comprehensive or specific about the kinds of decisions the agent is allowed to make can lead to confusion and conflict. For example, if the document does not clearly state the agent's authority regarding the withdrawal of life support, it could cause family disagreements or legal complications.
In conclusion, while the Five Wishes document provides a valuable way to express healthcare and personal wishes, careful consideration and detailed discussion are required to ensure that one's choices are understood and respected. Mistakes can be minimized by selecting an agent who is willing, able, and fully informed of their responsibilities, and by keeping the document up to date with any changes in one's personal or legal circumstances.
The Five Wishes Document is a crucial tool for expressing your health care preferences and ensuring your well-being is managed according to your desires, particularly in times when you might not be able to communicate your wishes yourself. While this document is comprehensive in its scope, incorporating other forms and documents can reinforce your intentions and provide a more robust legal and personal plan. Here is a list of other essential documents that are often used alongside the Five Wishes Document.
Each document plays a unique role in ensuring your personal, medical, and financial affairs are handled according to your wishes. Collectively, they provide a comprehensive approach to planning for the future, offering peace of mind to you and your loved ones. Remember, while the Five Wishes Document offers a broad platform for expressing your health care preferences, combining it with these other forms strengthens your legal and personal preparedness for different circumstances that may arise.
The Advance Directive, also known as a living will, exhibits a clear resemblance to the Five Wishes document, particularly in its function of delineating preferences for medical treatment when one is not able to make decisions independently. Similar to the Five Wishes, an advance directive facilitates an individual's choice regarding the continuation, withholding, or withdrawal of medical treatments. It specifies the types of medical interventions that are desired or not, mirroring the straightforward approach of Five Wishes in expressing personal, emotional, and spiritual needs alongside medical ones.
The Durable Power of Attorney for Health Care (DPOA-HC) parallels the Five Wishes document in its emphasis on appointing a specific individual to make health care decisions on one's behalf during incapacity. The primary function of a DPOA-HC is to designate a health care agent or proxy, mirroring the first wish in the Five Wishes document, which identifies a trusted person to make medical decisions. This reflects an analogous commitment to ensuring that one's healthcare preferences are respected, even when direct communication is no longer possible.
The POLST (Physician Orders for Life-Sustaining Treatment) form shares similarities with the Five Wishes document, especially in its approach to outlining medical interventions in serious health situations. Both documents are designed to guide healthcare professionals and loved ones through the decision-making process in accordance with the patient's wishes. However, POLST differs in that it is more medically detailed and is intended for individuals with serious health conditions, offering specific instructions for emergency medical personnel as well as other healthcare providers.
The Do Not Resuscitate (DNR) order, while more specific in scope, similarly relates to the domain covered by the Five Wishes document. A DNR focuses on a single, critical aspect of healthcare preferences—the refusal of cardiopulmonary resuscitation (CPR) in the event of cardiac or respiratory arrest. This decision is akin to the types of medical treatment preferences outlined in the Five Wishes, particularly concerning how one wishes to be treated in life-threatening situations.
The Ethical Will, though not a legal document, shares the spirit of the Five Wishes by providing a platform for expressing values, life lessons, and hopes for family members. Unlike the primarily medical focus of the Five Wishes, an ethical will deals with the emotional and spiritual legacy one wishes to leave behind. However, both documents underscore the importance of communication and the expression of one's desires, values, and needs to loved ones, thereby bridging personal, emotional, and medical care preferences.
When completing the 5 Wishes Document, it is crucial to approach it with careful consideration. This document significantly impacts your healthcare and personal wishes, so here are things you should and shouldn't do to ensure your wishes are effectively communicated:
Read the entire document carefully before you begin to fill it out, ensuring you understand each section and what it is asking of you.
Choose a Health Care Agent who knows you well, understands your wishes, and is willing to advocate on your behalf.
Discuss your wishes with the person you are appointing as your Health Care Agent before completing the document to ensure they are comfortable with the responsibility.
Be as detailed and clear as possible about your medical treatment preferences, comfort measures, how you want to be treated, and what you want your loved ones to know.
Consider including personal notes or additional instructions that might not be covered by the form's checkboxes and fields.
Review your state's requirements for legal documents like the 5 Wishes Document to ensure it will be recognized.
Sign and date the document in the presence of the required number of witnesses or a notary public, as per your state's regulations.
Distribute copies of the completed document to your Health Care Agent, family members, and your doctor, keeping the original in a safe but accessible place.
Revisit and update your 5 Wishes Document periodically or when your health situation or personal preferences change.
Destroy all previous versions of your living will or durable power of attorney for healthcare to avoid any confusion about your current wishes.
Rush through the document without giving thoughtful consideration to each section and decision.
Select a Health Care Agent based solely on their relationship to you without considering their ability and willingness to carry out your wishes.
Leave sections blank or unclear, as ambiguity could lead to confusion about your wishes during a critical time.
Forget to discuss your wishes with your loved ones and healthcare providers, even after you've completed the document.
Fail to check if additional documentation or steps are required to make your 5 Wishes Document legally binding in your state.
Assume that your healthcare providers are aware of your wishes without providing them with a copy of the document.
Neglect to review and, if necessary, update your document after major life events or changes in your health status.
Use the 5 Wishes Document as a substitute for open and ongoing conversations with your Health Care Agent and loved ones about your preferences and end-of-life care.
Overlook the importance of making extra copies and keeping the document in a digital format for easy access and distribution.
Consider this document as completely final; it’s vital to recognize that your preferences can change, and so should your 5 Wishes Document.
There are several common misconceptions about the Five Wishes document that need to be clarified so individuals can better understand its purpose and how it works. By addressing these misunderstandings, one can make informed decisions about end-of-life care planning.
Only for the Elderly: A major misunderstanding is that the Five Wishes document is just for the elderly. In reality, it's for anyone over the age of 18. Accidents and sudden illnesses can happen at any age, making it important for adults of all ages to express their wishes.
Legally Complex: Some people think that completing the Five Wishes document requires legal expertise. This isn't the case. The form was designed to be easy for anyone to fill out without needing legal knowledge. Its straightforward format helps you express your wishes clearly.
Only About Medical Wishes: Another common misconception is that the document only addresses medical treatments and procedures. However, Five Wishes also covers personal, emotional, and spiritual needs, allowing for a comprehensive approach to end-of-life planning.
A Replacement for a Will: People often confuse living wills, like the Five Wishes document, with last wills and testaments. The Five Wishes document is not a replacement for a will. It focuses on health care decisions and personal wishes in case of serious illness, while a last will and testament deals with the distribution of assets after death.
Valid in All States: There's a belief that once completed, the Five Wishes document is valid in all states. While it is true for many, it's not universally accepted across all 50 states. It substantially meets legal requirements in 42 states and the District of Columbia, but it's essential to check local laws to ensure compliance.
Does Not Require Witness or Notarization: While the Five Wishes document is user-friendly, it must be properly signed to be valid. Depending on your state’s law, this might require witnessing or notarization. Ignoring these legal formalities could render the document invalid.
Difficult to Amend: People often worry that once the Five Wishes document is signed, it cannot be changed. This is not true. You can update your wishes at any time by completing a new document and ensuring it is properly signed, witnessed, and notarized (if required by your state), then destroying copies of the old one.
No Need to Discuss with Family: Completing the form and putting it away without discussing it with your family and health care agent is a common mistake. For the document to serve its purpose effectively, it’s important that loved ones and those who will be making decisions on your behalf understand your wishes thoroughly.
Addressing these misconceptions allows individuals to create a Five Wishes document that reflects their true end-of-life care preferences and ensures that these wishes are respected and legally recognized.
The Five Wishes document is a comprehensive approach to guiding families and healthcare providers about your care preferences if you are unable to communicate them yourself. Here are five key takeaways to understand when filling out and using the form:
It’s essential for everyone, regardless of age or health status, to consider completing the Five Wishes document. Doing so can ease the burden on family members and ensure your care preferences are known and respected. Discussing your wishes with your designated Health Care Agent and loved ones ensures everyone involved is prepared and understands your desires, making the Five Wishes document an invaluable part of your care planning.
Florida Realtors Forms - A comprehensive agreement for the buying and selling of commercial real estate in Florida, outlining parties involved, terms, and conditions.
Florida Family Law Financial Affidavit Short Form - This document is also used in modifying existing orders for alimony or child support, reflecting current financial conditions not previously considered.
Fill a Valid 5 Wishes Document Form